LunaCross - To request information in the form of a question
Thanks for visiting our website, here you will be able to find all LunaCross answers.
The new wonderful word game developed by Fanatee Inc. Each stage contains a crossword grid with scrambled letters, like a word game or word search!
You must solve the clues and drag each letter to the right place, decoding the answers and completing the puzzle game. Unscramble letters in this quiz game and show your logic skills.
Access to hundreds of puzzles, right on your Android device, so play or review your crosswords when you want, wherever you want!
Become a master crossword solver while having tons of fun, and all for free!
With the new update released you will have plenty of difficult clues to solve and this website is available to help you at any time.
This page contains answers to puzzle To request information in the form of a question.
To request information in the form of a question
The answer to this question:
More answers from this puzzle:
- Selects, chooses
- Notes between fa and ti according to Julie Andrews
- Dry crust over a wound
- Mexican Pan's Labyrinth director, Guillermo del __
- Standard room category in a hotel
- US TV network with an eyeball logo
- Girl Scout cookies with caramel, toasted coconut
- Black residue found up a chimney
- Ukraine's 1st and 4th letters give its ISO code
- Years, in short
- Jeering sounds made by an audience
- Licensing and Regulatory Affairs
- Ammunition, for short
- Nickname of Peter Parker's alter ego
- Abbreviation for small spoon measure in baking
This question is used in these puzzles:
-
nbcvialmopeylpgaask
-
bbqassnlactatesukohanaburlttelsesduspsaidanaeskinsuitkatycns
-
scabcbstorosootammoannacespideyyrsadotsprohsamoasuaolafoptslarafeetasktera
-
casasmsjeontatcubanaaskliarsccsontodrhosllcanadseepapyrieveettaredbuff
-
acspysdstatuettekonazacdisstkrdnotueuoeraerlrdeppesqleapreinfectssyfwdet
-
acspysdstatuettekonazacdisstkrdnotueuoeraerlrdeppesqleapreinfectssyfwdet
Go back to puzzle list