LunaCross - Tempt with fine things
Thanks for visiting our website, here you will be able to find all LunaCross answers.
The new wonderful word game developed by Fanatee Inc. Each stage contains a crossword grid with scrambled letters, like a word game or word search!
You must solve the clues and drag each letter to the right place, decoding the answers and completing the puzzle game. Unscramble letters in this quiz game and show your logic skills.
Access to hundreds of puzzles, right on your Android device, so play or review your crosswords when you want, wherever you want!
Become a master crossword solver while having tons of fun, and all for free!
With the new update released you will have plenty of difficult clues to solve and this website is available to help you at any time.
This page contains answers to puzzle Tempt with fine things.
Tempt with fine things
The answer to this question:
More answers from this puzzle:
- Sparkling Italian wine produced in Piedmont region
- Airlines Reporting Corporation
- Activewear brand New Balance
- Black residue found up a chimney
- Doctor of Optometry is called this, not MD
- Fan Edition
- Nickname for a horse or football player
- Half of Major League Baseball, not American League
- Female Speaker of The House from Bush to Biden
- Third letter of the alphabet, spelled out
- Crosstalk, when signals interact unwantedly
- A female horse
- Onomatopoeia for wet things hitting the floor
- Spanish house
- Skin condition of broken blood vessels and redness
This question is used in these puzzles:
-
redmaxbrethartredcardodleesnbnpcasanlrosaceafootrestentice
-
cbscussoutoathoranearnprsvclieatmeknsadlydesktdallenrmbeetabaidaimopromcarsegaelk
Go back to puzzle list

(3 votes, average: 4,30 out of 5)