LunaCross - Prefix for "away from" or "external"
Thanks for visiting our website, here you will be able to find all LunaCross answers.
The new wonderful word game developed by Fanatee Inc. Each stage contains a crossword grid with scrambled letters, like a word game or word search!
You must solve the clues and drag each letter to the right place, decoding the answers and completing the puzzle game. Unscramble letters in this quiz game and show your logic skills.
Access to hundreds of puzzles, right on your Android device, so play or review your crosswords when you want, wherever you want!
Become a master crossword solver while having tons of fun, and all for free!
With the new update released you will have plenty of difficult clues to solve and this website is available to help you at any time.
This page contains answers to puzzle Prefix for "away from" or "external".
Prefix for "away from" or "external"
The answer to this question:
More answers from this puzzle:
- Let __, Elsa's memorable song in Disney's Frozen
- Veterans Day
- Say out loud to get the name Evie
- Income subject to tax minus specific deductions
- Abbreviation for transferal speed of computer data
- Chemical symbol for transition metal lutetium
- Acronym often seen after a dentist's name
- Public domain abbreviation on social media
- __ off; kept something at bay
- A substance that dissolves in a solvent
- Attractive in an endearing way
- Territory ruled by a Russian emperor
- Game canceled for excess precipitation
- Hopelessly __ to You from the Grease soundtrack
- Sleepy, exhausted
This question is used in these puzzles:
-
bpstsardomitgolurainoutevcutedevoteddds
-
cbscussoutoathoranearnprsvclieatmeknsadlydesktdallenrmbeetabaidaimopromcarsegaelk
Go back to puzzle list